PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv9_221020_azmu.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 752aa    MW: 83191.2 Da    PI: 6.144
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv9_221020_azmu.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.51.7e-2195150156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+k +++t++q++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  Bv9_221020_azmu.t1  95 RKKYHRHTADQIREMEALFKESPHPDEKQRQQLSKQLGLHPRQVKFWFQNRRTQIK 150
                         7999************************************************9877 PP

2START228.22.4e-712684913206
                         HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                           +a++el k+a+++ep+Wvks+    e++n+de++++f+ +++       +s+ea+r+s+vv+ ++++l+++++d++ qW+e ++    k
  Bv9_221020_azmu.t1 268 VDKALEELKKMATSGEPLWVKSVetgrEILNYDEYIKEFPVKNSsggakpkRSIEASRESRVVFVDVPRLLQSFMDVN-QWKEIFPclisK 357
                         678999*********************************887779*********************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a++++vi +g      ga+qlm+aelq+l+p+v+ R+++fvR+++ql+ ++w+ivdvSvd+ +++  ++s+++++++pSg++ie+ksngh+
  Bv9_221020_azmu.t1 358 AAVVDVIYNGeglnkdGAVQLMYAELQMLTPMVStREVYFVRCCKQLSPEQWAIVDVSVDNLEDNI-DASLIKCRKRPSGCIIEDKSNGHC 447
                         ****************************************************************98.9*********************** PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kvtwvehv+++++++h+l+r +v+sgla+gak+w+atlq qce+
  Bv9_221020_azmu.t1 448 KVTWVEHVECQKSIVHSLYRTIVNSGLAFGAKHWMATLQLQCER 491
                         ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.77E-2181153IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-2381146IPR009057Homeodomain-like
PROSITE profilePS5007117.96192152IPR001356Homeobox domain
SMARTSM003893.3E-1994156IPR001356Homeobox domain
PfamPF000468.4E-1995150IPR001356Homeobox domain
CDDcd000863.57E-1799150No hitNo description
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
PROSITE profilePS5084839.256257494IPR002913START domain
SuperFamilySSF559617.0E-36259491No hitNo description
CDDcd088753.28E-107261490No hitNo description
Gene3DG3DSA:3.30.530.201.3E-8264486IPR023393START-like domain
SMARTSM002349.4E-71266491IPR002913START domain
PfamPF018527.0E-58268491IPR002913START domain
SuperFamilySSF559613.6E-14520714No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MGVDMSNNPP NSQFPKDFFS SPALSLSLAG IFRGAEAAEG AAAKSAEVEE GEDTVEISSE  60
NSGPARSRSE DDFMINADDD DDDDGGDEKG KKKKRKKYHR HTADQIREME ALFKESPHPD  120
EKQRQQLSKQ LGLHPRQVKF WFQNRRTQIK AIQERHENSL LKTELEKMKE ENKSLRENTQ  180
KTSCPNCGFA TTSRGTIVTH DDQQQLKLEN ARLKAEVEKL RAVVGRYPSS SVSPTASCSA  240
TNDQVNRSSL DLYNGAFGID KSKIMEVVDK ALEELKKMAT SGEPLWVKSV ETGREILNYD  300
EYIKEFPVKN SSGGAKPKRS IEASRESRVV FVDVPRLLQS FMDVNQWKEI FPCLISKAAV  360
VDVIYNGEGL NKDGAVQLMY AELQMLTPMV STREVYFVRC CKQLSPEQWA IVDVSVDNLE  420
DNIDASLIKC RKRPSGCIIE DKSNGHCKVT WVEHVECQKS IVHSLYRTIV NSGLAFGAKH  480
WMATLQLQCE RLVFFMATNV PTKDSSGVAT LAGRKSILKL AQRMTWSFCR AVGASNFNSW  540
TKITTKTGED VRVASRKNLN DPGEPIGVIL CAVSSVWLPV SPSVVFDFLR DDTHRQEWDV  600
MANGGHVQLI ANLAKGQDRG NSVSIQTMKS KDNMNWVLQD SSINTFESMV VYAPVDISSI  660
QSVMTGCDSS NVAVLPSGFS ILPDGTESRP LVLTSVQEEK SSEGGCLLTI ALQVVTNSSP  720
AAKLTVESVE PVSSIISCIL ANIKTSLQCE DG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19095KKKKRK
29096KKKKRKK
39296KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010691342.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A0J8ECT30.0A0A0J8ECT3_BETVU; Uncharacterized protein
STRINGPOPTR_0003s05100.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein